SCOPe 2.06: Domain d2qjac_: 2qja C:

Lineage for d2qjac_ (2qja C:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)

6. Protein BMP receptor Ia ectodomain [57359] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57360] (11 PDB entries)

8. Domain d2qjac_: 2qja C: [238828]
   Other proteins in same PDB: d2qjaa_, d2qjab_
   automated match to d3qb4d_

Details for d2qjac_

PDB Entry: 2qja, 2.6 Å

PDB Description: crystal structure analysis of bmp-2 in complex with bmpr-ia variant b12

PDB Compounds: (C:) Bone morphogenetic protein receptor type IA

SCOPe Domain Sequences for d2qjac_:

Sequence; same for both SEQRES and ATOM records:

>d2qjac_ g.7.1.3 (C:) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]}
tlpflkcycsghcpddainntcitnghcfaiieeddqgettltsgclglegsdfqcrdtp
iphqrrsieccrtnlcnqylqptlp

Timeline for d2qjac_:

• d2qjac_ first appeared in SCOPe 2.04
  
• d2qjac_ appears in SCOPe 2.05
  
• d2qjac_ appears in SCOPe 2.07
  
• d2qjac_ appears in the current release, SCOPe 2.08