Lineage for d2q5dc_ (2q5d C:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1968131Fold g.88: Intrinsically disordered proteins [144255] (2 superfamilies)
    not a true fold
  4. 1968137Superfamily g.88.2: importin-beta binding (IBB) domain of snurportin-1 [254134] (2 families) (S)
  5. 1968138Family g.88.2.1: importin-beta binding (IBB) domain of snurportin-1 [254172] (1 protein)
    Pfam PF11538; PubMed 18187419
  6. 1968139Protein importin-beta binding (IBB) domain of snurportin-1 [254389] (1 species)
  7. 1968140Species Human (Homo sapiens) [TaxId:9606] [254822] (3 PDB entries)
  8. 1968143Domain d2q5dc_: 2q5d C: [238822]
    Other proteins in same PDB: d2q5da_, d2q5db_

Details for d2q5dc_

PDB Entry: 2q5d (more details), 3.2 Å

PDB Description: Crystal Structure of Human Importin Beta bound to the Snurportin1 IBB-domain second crystal form
PDB Compounds: (C:) Snurportin-1

SCOPe Domain Sequences for d2q5dc_:

Sequence, based on SEQRES records: (download)

>d2q5dc_ g.88.2.1 (C:) importin-beta binding (IBB) domain of snurportin-1 {Human (Homo sapiens) [TaxId: 9606]}
prlsqykskyssleqserrrrllelqkskrldyvnharr

Sequence, based on observed residues (ATOM records): (download)

>d2q5dc_ g.88.2.1 (C:) importin-beta binding (IBB) domain of snurportin-1 {Human (Homo sapiens) [TaxId: 9606]}
prlsqykskyeqserrrrllelqkskrldyvnharr

SCOPe Domain Coordinates for d2q5dc_:

Click to download the PDB-style file with coordinates for d2q5dc_.
(The format of our PDB-style files is described here.)

Timeline for d2q5dc_: