SCOPe 2.05: Domain d2q5dc_: 2q5d C:

Lineage for d2q5dc_ (2q5d C:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.88: Intrinsically disordered proteins [144255] (2 superfamilies)
   not a true fold

4. Superfamily g.88.2: importin-beta binding (IBB) domain of snurportin-1 [254134] (2 families)

5. Family g.88.2.1: importin-beta binding (IBB) domain of snurportin-1 [254172] (1 protein)
   Pfam PF11538; PubMed 18187419

6. Protein importin-beta binding (IBB) domain of snurportin-1 [254389] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [254822] (3 PDB entries)

8. Domain d2q5dc_: 2q5d C: [238822]
   Other proteins in same PDB: d2q5da_, d2q5db_

Details for d2q5dc_

PDB Entry: 2q5d, 3.2 Å

PDB Description: Crystal Structure of Human Importin Beta bound to the Snurportin1 IBB-domain second crystal form

PDB Compounds: (C:) Snurportin-1

SCOPe Domain Sequences for d2q5dc_:

Sequence, based on SEQRES records:

>d2q5dc_ g.88.2.1 (C:) importin-beta binding (IBB) domain of snurportin-1 {Human (Homo sapiens) [TaxId: 9606]}
prlsqykskyssleqserrrrllelqkskrldyvnharr

Sequence, based on observed residues (ATOM records):

>d2q5dc_ g.88.2.1 (C:) importin-beta binding (IBB) domain of snurportin-1 {Human (Homo sapiens) [TaxId: 9606]}
prlsqykskyeqserrrrllelqkskrldyvnharr

Timeline for d2q5dc_:

• d2q5dc_ first appeared in SCOPe 2.04
  
• d2q5dc_ appears in SCOPe 2.06
  
• d2q5dc_ appears in the current release, SCOPe 2.08