![]() | Class g: Small proteins [56992] (91 folds) |
![]() | Fold g.88: Intrinsically disordered proteins [144255] (2 superfamilies) not a true fold |
![]() | Superfamily g.88.2: importin-beta binding (IBB) domain of snurportin-1 [254134] (1 family) ![]() |
![]() | Family g.88.2.1: importin-beta binding (IBB) domain of snurportin-1 [254172] (1 protein) Pfam PF11538; PubMed 18187419 |
![]() | Protein importin-beta binding (IBB) domain of snurportin-1 [254389] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [254822] (3 PDB entries) |
![]() | Domain d2q5dc_: 2q5d C: [238822] Other proteins in same PDB: d2q5da_, d2q5db_ |
PDB Entry: 2q5d (more details), 3.2 Å
SCOPe Domain Sequences for d2q5dc_:
Sequence, based on SEQRES records: (download)
>d2q5dc_ g.88.2.1 (C:) importin-beta binding (IBB) domain of snurportin-1 {Human (Homo sapiens) [TaxId: 9606]} prlsqykskyssleqserrrrllelqkskrldyvnharr
>d2q5dc_ g.88.2.1 (C:) importin-beta binding (IBB) domain of snurportin-1 {Human (Homo sapiens) [TaxId: 9606]} prlsqykskyeqserrrrllelqkskrldyvnharr
Timeline for d2q5dc_: