| Class g: Small proteins [56992] (100 folds) |
| Fold g.88: Intrinsically disordered proteins [144255] (2 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily g.88.2: importin-beta binding (IBB) domain of snurportin-1 [254134] (2 families) ![]() |
| Family g.88.2.1: importin-beta binding (IBB) domain of snurportin-1 [254172] (1 protein) Pfam PF11538; PubMed 18187419 |
| Protein importin-beta binding (IBB) domain of snurportin-1 [254389] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [254822] (3 PDB entries) |
| Domain d2q5dc_: 2q5d C: [238822] Other proteins in same PDB: d2q5da_, d2q5db_ |
PDB Entry: 2q5d (more details), 3.2 Å
SCOPe Domain Sequences for d2q5dc_:
Sequence, based on SEQRES records: (download)
>d2q5dc_ g.88.2.1 (C:) importin-beta binding (IBB) domain of snurportin-1 {Human (Homo sapiens) [TaxId: 9606]}
prlsqykskyssleqserrrrllelqkskrldyvnharr
>d2q5dc_ g.88.2.1 (C:) importin-beta binding (IBB) domain of snurportin-1 {Human (Homo sapiens) [TaxId: 9606]}
prlsqykskyeqserrrrllelqkskrldyvnharr
Timeline for d2q5dc_: