Lineage for d2q5db_ (2q5d B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006405Protein Importin beta [48378] (3 species)
  7. 2006408Species Human (Homo sapiens) [TaxId:9606] [48379] (11 PDB entries)
  8. 2006426Domain d2q5db_: 2q5d B: [238821]
    Other proteins in same PDB: d2q5dc_, d2q5dd_
    automatically matched to d1m5ns_

Details for d2q5db_

PDB Entry: 2q5d (more details), 3.2 Å

PDB Description: Crystal Structure of Human Importin Beta bound to the Snurportin1 IBB-domain second crystal form
PDB Compounds: (B:) importin beta-1 subunit

SCOPe Domain Sequences for d2q5db_:

Sequence, based on SEQRES records: (download)

>d2q5db_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]}
melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
iknsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacae
ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
svvvrdtaawtvgricellpeaaindvylapllqclieglsaeprvasnvcwafsslaea
ayeaadvaddqeepatyclsssfelivqkllettdrpdghqnnlrssayeslmeivknsa
kdcypavqkttlvimerlqqvlqmeshiqstsdriqfndlqsllcatlqnvlrkvqhqda
lqisdvvmasllrmfqstagsggvqedalmavstlvevlggeflkymeafkpflgiglkn
yaeyqvclaavglvgdlcralqsniipfcdevmqlllenlgnenvhrsvkpqilsvfgdi
alaiggefkkylevvlntlqqasqaqvdksdydmvdylnelrescleaytgivqglkgdq
envhpdvmlvqprvefilsfidhiagdedhtdgvvacaagligdlctafgkdvlklvear
pmihelltegrrsktnkaktlatwatkelrklknqa

Sequence, based on observed residues (ATOM records): (download)

>d2q5db_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]}
melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
iknsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacae
ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
svvvrdtaawtvgricellpeaaindvylapllqclieglsaeprvasnvcwafsslaea
ayeaadvaddqeepatyclsssfelivqkllettdrpdghqnnlrssayeslmeivknsa
kdcypavqkttlvimerlqqvlqmsdriqfndlqsllcatlqnvlrkvqhqdalqisdvv
masllrmfqstagsggvqedalmavstlvevlggeflkymeafkpflgigqvclaavglv
gdlcralqsniipfcdevmqlllenlgnenvhrsvkpqilsvfgdialaiggefkkylev
vlntlqqasqaqvylnelrescleaytgivqgqpdvmlvqprvefilsfidhiagdedht
dgvvacaagligdlctafgkdvlklvearpmihelltegrrsktnkaktlatwatkelrk
lknqa

SCOPe Domain Coordinates for d2q5db_:

Click to download the PDB-style file with coordinates for d2q5db_.
(The format of our PDB-style files is described here.)

Timeline for d2q5db_: