SCOPe 2.05: Domain d2pukg_: 2puk G:

Lineage for d2pukg_ (2puk G:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein automated matches [190442] (13 species)
   not a true protein

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [187345] (2 PDB entries)

8. Domain d2pukg_: 2puk G: [238817]
   Other proteins in same PDB: d2puka_, d2pukb_, d2puke_, d2pukf_
   automated match to d1dbya_
   complexed with sf4

Details for d2pukg_

PDB Entry: 2puk, 3 Å

PDB Description: crystal structure of the binary complex between ferredoxin: thioredoxin reductase and thioredoxin m

PDB Compounds: (G:) Thioredoxin M-type, chloroplast (TRX-M)

SCOPe Domain Sequences for d2pukg_:

Sequence; same for both SEQRES and ATOM records:

>d2pukg_ c.47.1.1 (G:) automated matches {Spinach (Spinacia oleracea) [TaxId: 3562]}
evqdvndsswkefvlesevpvmvdfwapwcgpskliapvidelakeysgkiavyklntde
apgiatqynirsiptvlffkngerkesiigavpkstltdsiekyl

Timeline for d2pukg_:

• d2pukg_ first appeared in SCOPe 2.04
  
• d2pukg_ appears in SCOPe 2.06
  
• d2pukg_ appears in the current release, SCOPe 2.08