Lineage for d2pukg_ (2puk G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876445Protein automated matches [190442] (13 species)
    not a true protein
  7. 2876518Species Spinach (Spinacia oleracea) [TaxId:3562] [187345] (2 PDB entries)
  8. 2876521Domain d2pukg_: 2puk G: [238817]
    Other proteins in same PDB: d2puka_, d2pukb_, d2puke2, d2puke3, d2pukf_
    automated match to d1dbya_
    complexed with sf4

Details for d2pukg_

PDB Entry: 2puk (more details), 3 Å

PDB Description: crystal structure of the binary complex between ferredoxin: thioredoxin reductase and thioredoxin m
PDB Compounds: (G:) Thioredoxin M-type, chloroplast (TRX-M)

SCOPe Domain Sequences for d2pukg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pukg_ c.47.1.1 (G:) automated matches {Spinach (Spinacia oleracea) [TaxId: 3562]}
evqdvndsswkefvlesevpvmvdfwapwcgpskliapvidelakeysgkiavyklntde
apgiatqynirsiptvlffkngerkesiigavpkstltdsiekyl

SCOPe Domain Coordinates for d2pukg_:

Click to download the PDB-style file with coordinates for d2pukg_.
(The format of our PDB-style files is described here.)

Timeline for d2pukg_: