Lineage for d2pqmb_ (2pqm B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2514799Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2514800Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2515225Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2515226Protein automated matches [190215] (38 species)
    not a true protein
  7. 2515265Species Entamoeba histolytica [TaxId:294381] [225437] (5 PDB entries)
  8. 2515267Domain d2pqmb_: 2pqm B: [238814]
    Other proteins in same PDB: d2pqma2
    automated match to d2pqma_
    complexed with plp, so4

Details for d2pqmb_

PDB Entry: 2pqm (more details), 1.86 Å

PDB Description: Crystal structure of Cysteine Synthase (OASS) from Entamoeba histolytica at 1.86 A resolution
PDB Compounds: (B:) Cysteine synthase

SCOPe Domain Sequences for d2pqmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pqmb_ c.79.1.0 (B:) automated matches {Entamoeba histolytica [TaxId: 294381]}
qisissprkriyhniletiggtplvelhgvtehprikkgtrilvkleyfnpmssvkdrvg
fnivyqaikdgrlkpgmeiiestsgntgialcqagavfgyrvniampstmsverqmimka
fgaeliltegkkgmpgaieevnkmikenpgkyfvanqfgnpdntaahhytaneiwedtdg
evdivvsavgtsgtvigvaeklkekkkgikiiavepeesavlegkakgphgiqgigagfi
pdiykkefvdeiipiktqdawkmaravvkydgimcgmssgaailaglkeaekpenegkti
viivpscgerylstdlykikdegtkiqildslln

SCOPe Domain Coordinates for d2pqmb_:

Click to download the PDB-style file with coordinates for d2pqmb_.
(The format of our PDB-style files is described here.)

Timeline for d2pqmb_: