SCOPe 2.08: Domain d2ppbo_: 2ppb O:

Lineage for d2ppbo_ (2ppb O:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
   core: 2 helices and adjacent loops

4. Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families)
   the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits

5. Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
   4 helices; irregular array

6. Protein RNA polymerase omega subunit [63564] (3 species)

7. Species Thermus thermophilus HB8 [TaxId:300852] [158241] (6 PDB entries)

8. Domain d2ppbo_: 2ppb O: [238813]
   Other proteins in same PDB: d2ppbc_, d2ppbd_, d2ppbm_, d2ppbn_
   automated match to d1i6ve_
   protein/DNA complex; protein/RNA complex; complexed with apc, mg, std, zn

Details for d2ppbo_

PDB Entry: 2ppb, 3 Å

PDB Description: Crystal structure of the T. thermophilus RNAP polymerase elongation complex with the ntp substrate analog and antibiotic streptolydigin

PDB Compounds: (O:) DNA-directed RNA polymerase omega chain

SCOPe Domain Sequences for d2ppbo_:

Sequence; same for both SEQRES and ATOM records:

>d2ppbo_ a.143.1.1 (O:) RNA polymerase omega subunit {Thermus thermophilus HB8 [TaxId: 300852]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav
twamkelltgrlvfgenlvpedrlqkemerlypve

Timeline for d2ppbo_:

• d2ppbo_ first appeared in SCOPe 2.04
  
• d2ppbo_ appears in SCOPe 2.07