![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily) beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134 |
![]() | Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) ![]() |
![]() | Family d.101.1.0: automated matches [227218] (1 protein) not a true family |
![]() | Protein automated matches [226956] (5 species) not a true protein |
![]() | Species Pyrococcus abyssi [TaxId:29292] [225428] (4 PDB entries) |
![]() | Domain d2po2b2: 2po2 B:188-274 [238811] Other proteins in same PDB: d2po2a1, d2po2b1 automated match to d2wnra2 complexed with cdp, mpd |
PDB Entry: 2po2 (more details), 2.41 Å
SCOPe Domain Sequences for d2po2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2po2b2 d.101.1.0 (B:188-274) automated matches {Pyrococcus abyssi [TaxId: 29292]} pvekipvpvtfakignilvvdpsldeelvmdgkitittdetghisavqkseggafkleev myavetafkkaeeirklileavekakq
Timeline for d2po2b2: