SCOPe 2.08: Domain d2po2b1: 2po2 B:8-187

Lineage for d2po2b1 (2po2 B:8-187)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.0: automated matches [191504] (1 protein)
   not a true family

6. Protein automated matches [190826] (23 species)
   not a true protein

7. Species Pyrococcus abyssi [TaxId:29292] [225427] (4 PDB entries)

8. Domain d2po2b1: 2po2 B:8-187 [238810]
   Other proteins in same PDB: d2po2a2, d2po2b2
   automated match to d2wnra1
   complexed with cdp, mpd

Details for d2po2b1

PDB Entry: 2po2, 2.41 Å

PDB Description: Crystal structure of the P. abyssi exosome RNase PH ring complexed with CDP

PDB Compounds: (B:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d2po2b1:

Sequence; same for both SEQRES and ATOM records:

>d2po2b1 d.14.1.0 (B:8-187) automated matches {Pyrococcus abyssi [TaxId: 29292]}
agimrdhiinllkegkriddrgfedyrpieievgviekaegsalvklgstqvlvgiktsl
gepfpdtpnmgvmttnvelvplasptfepgppderaielarvidrgireskalnlekmvi
vpgkivrvvfidvhvldhdgnlmdaigiaaiaallnarvpkvryneetgevetldetepl

Timeline for d2po2b1:

• d2po2b1 first appeared in SCOPe 2.04
  
• d2po2b1 appears in SCOPe 2.07