Lineage for d2po2b1 (2po2 B:8-187)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930912Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2930913Protein automated matches [190826] (23 species)
    not a true protein
  7. 2931135Species Pyrococcus abyssi [TaxId:29292] [225427] (4 PDB entries)
  8. 2931143Domain d2po2b1: 2po2 B:8-187 [238810]
    Other proteins in same PDB: d2po2a2, d2po2b2
    automated match to d2wnra1
    complexed with cdp, mpd

Details for d2po2b1

PDB Entry: 2po2 (more details), 2.41 Å

PDB Description: Crystal structure of the P. abyssi exosome RNase PH ring complexed with CDP
PDB Compounds: (B:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d2po2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2po2b1 d.14.1.0 (B:8-187) automated matches {Pyrococcus abyssi [TaxId: 29292]}
agimrdhiinllkegkriddrgfedyrpieievgviekaegsalvklgstqvlvgiktsl
gepfpdtpnmgvmttnvelvplasptfepgppderaielarvidrgireskalnlekmvi
vpgkivrvvfidvhvldhdgnlmdaigiaaiaallnarvpkvryneetgevetldetepl

SCOPe Domain Coordinates for d2po2b1:

Click to download the PDB-style file with coordinates for d2po2b1.
(The format of our PDB-style files is described here.)

Timeline for d2po2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2po2b2