Lineage for d2tnfb_ (2tnf B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777173Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2777391Protein Tumor necrosis factor (TNF) [49848] (3 species)
  7. 2777538Species Mouse (Mus musculus) [TaxId:10090] [49850] (3 PDB entries)
  8. 2777540Domain d2tnfb_: 2tnf B: [23881]
    complexed with ipa, trs

Details for d2tnfb_

PDB Entry: 2tnf (more details), 1.4 Å

PDB Description: 1.4 a resolution structure of mouse tumor necrosis factor, towards modulation of its selectivity and trimerisation
PDB Compounds: (B:) protein (tumor necrosis factor alpha)

SCOPe Domain Sequences for d2tnfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tnfb_ b.22.1.1 (B:) Tumor necrosis factor (TNF) {Mouse (Mus musculus) [TaxId: 10090]}
sdkpvahvvanhqveeqlewlsqranallangmdlkdnqlvvpadglylvysqvlfkgqg
cpdyvllthtvsrfaisyqekvnllsavkspcpkdtpegaelkpwyepiylggvfqlekg
dqlsaevnlpkyldfaesgqvyfgvial

SCOPe Domain Coordinates for d2tnfb_:

Click to download the PDB-style file with coordinates for d2tnfb_.
(The format of our PDB-style files is described here.)

Timeline for d2tnfb_: