SCOPe 2.04: Domain d2po1b2: 2po1 B:188-274

Lineage for d2po1b2 (2po1 B:188-274)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134

4. Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families)

5. Family d.101.1.0: automated matches [227218] (1 protein)
   not a true family

6. Protein automated matches [226956] (5 species)
   not a true protein

7. Species Pyrococcus abyssi [TaxId:29292] [225428] (4 PDB entries)

8. Domain d2po1b2: 2po1 B:188-274 [238809]
   Other proteins in same PDB: d2po1a1, d2po1b1
   automated match to d2wnra2
   protein/RNA complex; complexed with mpd

Details for d2po1b2

PDB Entry: 2po1, 1.94 Å

PDB Description: Crystal structure of the P. abyssi exosome RNase PH ring complexed with a single stranded 10-mer poly(A) RNA

PDB Compounds: (B:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d2po1b2:

Sequence; same for both SEQRES and ATOM records:

>d2po1b2 d.101.1.0 (B:188-274) automated matches {Pyrococcus abyssi [TaxId: 29292]}
pvekipvpvtfakignilvvdpsldeelvmdgkitittdetghisavqkseggafkleev
myavetafkkaeeirklileavekakq

Timeline for d2po1b2:

• d2po1b2 is new in SCOPe 2.04-stable
  
• d2po1b2 appears in SCOPe 2.05
  
• d2po1b2 appears in the current release, SCOPe 2.08