Lineage for d2po1b1 (2po1 B:8-187)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2538081Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2538082Protein automated matches [190826] (22 species)
    not a true protein
  7. 2538276Species Pyrococcus abyssi [TaxId:29292] [225427] (4 PDB entries)
  8. 2538278Domain d2po1b1: 2po1 B:8-187 [238808]
    Other proteins in same PDB: d2po1a2, d2po1b2
    automated match to d2wnra1
    protein/RNA complex; complexed with mpd

Details for d2po1b1

PDB Entry: 2po1 (more details), 1.94 Å

PDB Description: Crystal structure of the P. abyssi exosome RNase PH ring complexed with a single stranded 10-mer poly(A) RNA
PDB Compounds: (B:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d2po1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2po1b1 d.14.1.0 (B:8-187) automated matches {Pyrococcus abyssi [TaxId: 29292]}
agimrdhiinllkegkriddrgfedyrpieievgviekaegsalvklgstqvlvgiktsl
gepfpdtpnmgvmttnvelvplasptfepgppderaielarvidrgireskalnlekmvi
vpgkivrvvfidvhvldhdgnlmdaigiaaiaallnarvpkvryneetgevetldetepl

SCOPe Domain Coordinates for d2po1b1:

Click to download the PDB-style file with coordinates for d2po1b1.
(The format of our PDB-style files is described here.)

Timeline for d2po1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2po1b2