Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
Protein automated matches [190826] (23 species) not a true protein |
Species Pyrococcus abyssi [TaxId:29292] [225427] (4 PDB entries) |
Domain d2po1b1: 2po1 B:8-187 [238808] Other proteins in same PDB: d2po1a2, d2po1b2 automated match to d2wnra1 protein/RNA complex; complexed with mpd |
PDB Entry: 2po1 (more details), 1.94 Å
SCOPe Domain Sequences for d2po1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2po1b1 d.14.1.0 (B:8-187) automated matches {Pyrococcus abyssi [TaxId: 29292]} agimrdhiinllkegkriddrgfedyrpieievgviekaegsalvklgstqvlvgiktsl gepfpdtpnmgvmttnvelvplasptfepgppderaielarvidrgireskalnlekmvi vpgkivrvvfidvhvldhdgnlmdaigiaaiaallnarvpkvryneetgevetldetepl
Timeline for d2po1b1: