| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
| Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
| Protein automated matches [190826] (23 species) not a true protein |
| Species Pyrococcus abyssi [TaxId:29292] [225427] (4 PDB entries) |
| Domain d2po0b1: 2po0 B:8-187 [238806] Other proteins in same PDB: d2po0a2, d2po0b2 automated match to d2wnra1 complexed with adp, mpd |
PDB Entry: 2po0 (more details), 2.3 Å
SCOPe Domain Sequences for d2po0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2po0b1 d.14.1.0 (B:8-187) automated matches {Pyrococcus abyssi [TaxId: 29292]}
agimrdhiinllkegkriddrgfedyrpieievgviekaegsalvklgstqvlvgiktsl
gepfpdtpnmgvmttnvelvplasptfepgppderaielarvidrgireskalnlekmvi
vpgkivrvvfidvhvldhdgnlmdaigiaaiaallnarvpkvryneetgevetldetepl
Timeline for d2po0b1: