SCOPe 2.08: Domain d2pnzb2: 2pnz B:188-274

Lineage for d2pnzb2 (2pnz B:188-274)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134

4. Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families)

5. Family d.101.1.0: automated matches [227218] (1 protein)
   not a true family

6. Protein automated matches [226956] (5 species)
   not a true protein

7. Species Pyrococcus abyssi [TaxId:29292] [225428] (4 PDB entries)

8. Domain d2pnzb2: 2pnz B:188-274 [238805]
   Other proteins in same PDB: d2pnza1, d2pnzb1
   automated match to d2wnra2
   complexed with 5gp, mpd, udp

Details for d2pnzb2

PDB Entry: 2pnz, 2.14 Å

PDB Description: Crystal structure of the P. abyssi exosome RNase PH ring complexed with UDP and GMP

PDB Compounds: (B:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d2pnzb2:

Sequence; same for both SEQRES and ATOM records:

>d2pnzb2 d.101.1.0 (B:188-274) automated matches {Pyrococcus abyssi [TaxId: 29292]}
pvekipvpvtfakignilvvdpsldeelvmdgkitittdetghisavqkseggafkleev
myavetafkkaeeirklileavekakq

Timeline for d2pnzb2:

• d2pnzb2 first appeared in SCOPe 2.04
  
• d2pnzb2 appears in SCOPe 2.07