SCOPe 2.08: Domain d2pmqb2: 2pmq B:126-367

Lineage for d2pmqb2 (2pmq B:126-367)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (79 species)
   not a true protein

7. Species Roseovarius sp. [TaxId:314265] [231165] (1 PDB entry)

8. Domain d2pmqb2: 2pmq B:126-367 [238803]
   Other proteins in same PDB: d2pmqa1, d2pmqa3, d2pmqb1, d2pmqb3
   automated match to d2pmqa2
   complexed with mg

Details for d2pmqb2

PDB Entry: 2pmq, 1.72 Å

PDB Description: crystal structure of a mandelate racemase/muconate lactonizing enzyme from roseovarius sp. htcc2601

PDB Compounds: (B:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d2pmqb2:

Sequence; same for both SEQRES and ATOM records:

>d2pmqb2 c.1.11.0 (B:126-367) automated matches {Roseovarius sp. [TaxId: 314265]}
altdsvssyyslgvmepdeaarqalekqregysrlqvklgarpieidieairkvweavrg
tgialaadgnrgwttrdalrfsrecpdipfvmeqpcnsfedleairplchhalymdedgt
slntvitaaatslvdgfgmkvsrigglqhmrafrdfcaarnlphtcddawggdivsaact
hiastvlprlmegawlaqpyvaehydaengvrieggrirvpqgpglgltidperfgpplf
sa

Timeline for d2pmqb2:

• d2pmqb2 first appeared in SCOPe 2.04
  
• d2pmqb2 appears in SCOPe 2.07