Lineage for d2pgwf1 (2pgw F:4-131)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948567Species Sinorhizobium meliloti [TaxId:266834] [231146] (1 PDB entry)
  8. 2948573Domain d2pgwf1: 2pgw F:4-131 [238796]
    Other proteins in same PDB: d2pgwa2, d2pgwb2, d2pgwc2, d2pgwc3, d2pgwd2, d2pgwe2, d2pgwf2, d2pgwg2, d2pgwh2
    automated match to d2pgwb1
    complexed with gol

Details for d2pgwf1

PDB Entry: 2pgw (more details), 1.95 Å

PDB Description: crystal structure of a putative muconate cycloisomerase from sinorhizobium meliloti 1021
PDB Compounds: (F:) Muconate cycloisomerase

SCOPe Domain Sequences for d2pgwf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pgwf1 d.54.1.0 (F:4-131) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
vkisnvrvrplvlplkqpyhwsygiresfavnlieieaddgtvgigectvapdqtgtaai
lyrlakhlvghsphdvapliarifhqeylghganimraanqifsgidmamwdlqgklagl
pvhqllgg

SCOPe Domain Coordinates for d2pgwf1:

Click to download the PDB-style file with coordinates for d2pgwf1.
(The format of our PDB-style files is described here.)

Timeline for d2pgwf1: