Lineage for d2p8qb_ (2p8q B:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2643576Fold g.88: Intrinsically disordered proteins [144255] (2 superfamilies)
    not a true fold
  4. 2643582Superfamily g.88.2: importin-beta binding (IBB) domain of snurportin-1 [254134] (2 families) (S)
  5. 2643583Family g.88.2.1: importin-beta binding (IBB) domain of snurportin-1 [254172] (1 protein)
    Pfam PF11538; PubMed 18187419
  6. 2643584Protein importin-beta binding (IBB) domain of snurportin-1 [254389] (1 species)
  7. 2643585Species Human (Homo sapiens) [TaxId:9606] [254822] (3 PDB entries)
  8. 2643586Domain d2p8qb_: 2p8q B: [238793]
    Other proteins in same PDB: d2p8qa_

Details for d2p8qb_

PDB Entry: 2p8q (more details), 2.35 Å

PDB Description: Crystal Structure of human Importin beta bound to the Snurportin1 IBB-domain
PDB Compounds: (B:) Snurportin-1

SCOPe Domain Sequences for d2p8qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p8qb_ g.88.2.1 (B:) importin-beta binding (IBB) domain of snurportin-1 {Human (Homo sapiens) [TaxId: 9606]}
prlsqykskyssleqserrrrllelqkskrldyvnharr

SCOPe Domain Coordinates for d2p8qb_:

Click to download the PDB-style file with coordinates for d2p8qb_.
(The format of our PDB-style files is described here.)

Timeline for d2p8qb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2p8qa_