SCOPe 2.08: Domain d2p8qb_: 2p8q B:

Lineage for d2p8qb_ (2p8q B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.88: Intrinsically disordered proteins [144255] (2 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily g.88.2: importin-beta binding (IBB) domain of snurportin-1 [254134] (2 families)

5. Family g.88.2.1: importin-beta binding (IBB) domain of snurportin-1 [254172] (1 protein)
   Pfam PF11538; PubMed 18187419

6. Protein importin-beta binding (IBB) domain of snurportin-1 [254389] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [254822] (3 PDB entries)

8. Domain d2p8qb_: 2p8q B: [238793]
   Other proteins in same PDB: d2p8qa_

Details for d2p8qb_

PDB Entry: 2p8q, 2.35 Å

PDB Description: Crystal Structure of human Importin beta bound to the Snurportin1 IBB-domain

PDB Compounds: (B:) Snurportin-1

SCOPe Domain Sequences for d2p8qb_:

Sequence; same for both SEQRES and ATOM records:

>d2p8qb_ g.88.2.1 (B:) importin-beta binding (IBB) domain of snurportin-1 {Human (Homo sapiens) [TaxId: 9606]}
prlsqykskyssleqserrrrllelqkskrldyvnharr

Timeline for d2p8qb_:

• d2p8qb_ first appeared in SCOPe 2.04
  
• d2p8qb_ appears in SCOPe 2.07