SCOPe 2.08: Domain d2ouvb1: 2ouv B:449-773

Lineage for d2ouvb1 (2ouv B:449-773)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries)

8. Domain d2ouvb1: 2ouv B:449-773 [238791]
   Other proteins in same PDB: d2ouva2, d2ouvb2
   automated match to d2ouva_
   complexed with mg, zn; mutant

Details for d2ouvb1

PDB Entry: 2ouv, 1.56 Å

PDB Description: crystal structure of pde10a2 mutant of d564n

PDB Compounds: (B:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d2ouvb1:

Sequence; same for both SEQRES and ATOM records:

>d2ouvb1 a.211.1.0 (B:449-773) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl
crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchnldhr
gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk
aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtklt
andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt
epllkacrdnlsqwekvirgeetat

Timeline for d2ouvb1:

• d2ouvb1 first appeared in SCOPe 2.04, called d2ouvb_
  
• d2ouvb1 appears in SCOPe 2.07