SCOPe 2.05: Domain d2tunf_: 2tun F:

Lineage for d2tunf_ (2tun F:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.1: TNF-like [49843] (15 proteins)

6. Protein Tumor necrosis factor (TNF) [49848] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49849] (13 PDB entries)

8. Domain d2tunf_: 2tun F: [23879]
   mutant

Details for d2tunf_

PDB Entry: 2tun, 3.1 Å

PDB Description: conformational changes in the (ala-84-val) mutant of tumor necrosis factor

PDB Compounds: (F:) tumor necrosis factor-alpha

SCOPe Domain Sequences for d2tunf_:

Sequence; same for both SEQRES and ATOM records:

>d2tunf_ b.22.1.1 (F:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]}
tpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkg
qgcpsthvllthtisrivvsyqtkvnllsaikspcqretpegaeakpwyepiylggvfql
ekgdrlsaeinrpdyllfaesgqvyfgiial

Timeline for d2tunf_:

• d2tunf_ first appeared (with stable ids) in SCOP 1.55
  
• d2tunf_ appears in SCOPe 2.04
  
• d2tunf_ appears in SCOPe 2.06
  
• d2tunf_ appears in the current release, SCOPe 2.08