SCOP 1.59: Domain d2tunf_: 2tun F:

Lineage for d2tunf_ (2tun F:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)

4. Superfamily b.22.1: TNF-like [49842] (1 family)

5. Family b.22.1.1: TNF-like [49843] (7 proteins)

6. Protein Tumor necrosis factor (TNF) [49848] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49849] (6 PDB entries)

8. Domain d2tunf_: 2tun F: [23879]

Details for d2tunf_

PDB Entry: 2tun, 3.1 Å

PDB Description: conformational changes in the (ala-84-val) mutant of tumor necrosis factor

SCOP Domain Sequences for d2tunf_:

Sequence; same for both SEQRES and ATOM records:

>d2tunf_ b.22.1.1 (F:) Tumor necrosis factor (TNF) {Human (Homo sapiens)}
tpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkg
qgcpsthvllthtisrivvsyqtkvnllsaikspcqretpegaeakpwyepiylggvfql
ekgdrlsaeinrpdyllfaesgqvyfgiial

Timeline for d2tunf_:

• d2tunf_ first appeared (with stable ids) in SCOP 1.55
  
• d2tunf_ appears in SCOP 1.57
  
• d2tunf_ appears in SCOP 1.61
  
• d2tunf_ appears in the current release, SCOPe 2.08