Lineage for d2ormb_ (2orm B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2960762Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2960763Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2961445Family d.80.1.0: automated matches [191533] (1 protein)
    not a true family
  6. 2961446Protein automated matches [190903] (22 species)
    not a true protein
  7. 2961548Species Helicobacter pylori [TaxId:85963] [231104] (2 PDB entries)
  8. 2961550Domain d2ormb_: 2orm B: [238785]
    automated match to d2orma_

Details for d2ormb_

PDB Entry: 2orm (more details), 2.1 Å

PDB Description: Crystal Structure of the 4-Oxalocrotonate Tautomerase Homologue DmpI from Helicobacter pylori.
PDB Compounds: (B:) Probable tautomerase HP0924

SCOPe Domain Sequences for d2ormb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ormb_ d.80.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 85963]}
pfiniklvpenggptneqkqqliegvsdlmvkvlnknkasivviidevdsnnyglggesv
hhlrq

SCOPe Domain Coordinates for d2ormb_:

Click to download the PDB-style file with coordinates for d2ormb_.
(The format of our PDB-style files is described here.)

Timeline for d2ormb_: