SCOPe 2.08: Domain d2or8b1: 2or8 B:1-112

Lineage for d2or8b1 (2or8 B:1-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d2or8b1: 2or8 B:1-112 [238783]
   Other proteins in same PDB: d2or8a2, d2or8b2
   automated match to d2or8a_
   complexed with act

Details for d2or8b1

PDB Entry: 2or8, 2.5 Å

PDB Description: Tim-1

PDB Compounds: (B:) Hepatitis A virus cellular receptor 1 homolog

SCOPe Domain Sequences for d2or8b1:

Sequence; same for both SEQRES and ATOM records:

>d2or8b1 b.1.1.0 (B:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mdsyvevkgvvghpvtlpctystyrgitttcwgrgqcpssacqntliwtnghrvtyqkss
rynlkghisegdvsltiensvesdsglyccrveipgwfndqkvtfslqvkpe

Timeline for d2or8b1:

• d2or8b1 first appeared in SCOPe 2.04, called d2or8b_
  
• d2or8b1 appears in SCOPe 2.07