Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (79 species) not a true protein |
Species Streptomyces coelicolor [TaxId:100226] [231096] (3 PDB entries) |
Domain d2oqhb2: 2oqh B:123-376 [238780] Other proteins in same PDB: d2oqha1, d2oqha3, d2oqhb1, d2oqhb3, d2oqhc1, d2oqhc3, d2oqhd1, d2oqhd3 automated match to d2oqha2 complexed with so4 |
PDB Entry: 2oqh (more details), 1.98 Å
SCOPe Domain Sequences for d2oqhb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oqhb2 c.1.11.0 (B:123-376) automated matches {Streptomyces coelicolor [TaxId: 100226]} avrdevpitalitradapgatpadlpkamaehavrvveeggfdavklkgttdcagdvail ravrealpgvnlrvdpnaawsvpdsvragialeeldleyledpcvgiegmaqvkakvrip lctnmcvvrfedfapamrlnavdvihgdvykwggiaatkalaahcetfglgmnlhsggel giataahlavvsstpvlsraidsmyylhaddiieplhlengrlrvpsgpglgvsvdedkl rhyagvnerdgdlt
Timeline for d2oqhb2: