Lineage for d2tune_ (2tun E:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57410Fold b.22: TNF-like [49841] (1 superfamily)
  4. 57411Superfamily b.22.1: TNF-like [49842] (1 family) (S)
  5. 57412Family b.22.1.1: TNF-like [49843] (5 proteins)
  6. 57440Protein Tumor necrosis factor (TNF) [49848] (2 species)
  7. 57441Species Human (Homo sapiens) [TaxId:9606] [49849] (6 PDB entries)
  8. 57460Domain d2tune_: 2tun E: [23878]

Details for d2tune_

PDB Entry: 2tun (more details), 3.1 Å

PDB Description: conformational changes in the (ala-84-val) mutant of tumor necrosis factor

SCOP Domain Sequences for d2tune_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tune_ b.22.1.1 (E:) Tumor necrosis factor (TNF) {Human (Homo sapiens)}
tpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkg
qgcpsthvllthtisrivvsyqtkvnllsaikspcqretpegaeakpwyepiylggvfql
ekgdrlsaeinrpdyllfaesgqvyfgiial

SCOP Domain Coordinates for d2tune_:

Click to download the PDB-style file with coordinates for d2tune_.
(The format of our PDB-style files is described here.)

Timeline for d2tune_: