Lineage for d2tune_ (2tun E:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.22: TNF-like [49841] (1 superfamily) Superfamily b.22.1: TNF-like [49842] (1 family) 
Family b.22.1.1: TNF-like [49843] (4 proteins) 
Protein Tumor necrosis factor (TNF) [49848] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [49849] (6 PDB entries) 
Domain d2tune_: 2tun E: [23878]
Details for d2tune_
PDB Entry: 2tun (more details), 3.1 Å
PDB Description: conformational changes in the (ala-84-val) mutant of tumor necrosis factor
SCOP Domain Sequences for d2tune_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tune_ b.22.1.1 (E:) Tumor necrosis factor (TNF) {Human (Homo sapiens)}
tpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkg
qgcpsthvllthtisrivvsyqtkvnllsaikspcqretpegaeakpwyepiylggvfql
ekgdrlsaeinrpdyllfaesgqvyfgiial
SCOP Domain Coordinates for d2tune_:
Click to download the PDB-style file with coordinates for d2tune_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2tune_:
- d2tune_ appears in SCOP 1.57
- d2tune_ appears in the current release, SCOPe 2.08
View in 3D
