Lineage for d2omxa3 (2omx A:36-417)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2851705Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2851706Family c.10.2.1: Internalin LRR domain [52059] (4 proteins)
    capped at the N-end with a truncated EF-hand subdomain
    this is a repeat family; one repeat unit is 2omx A:261-239 found in domain
  6. 2851707Protein Internalin A [82324] (1 species)
  7. 2851708Species Listeria monocytogenes [TaxId:1639] [82325] (10 PDB entries)
  8. 2851715Domain d2omxa3: 2omx A:36-417 [238776]
    Other proteins in same PDB: d2omxa1, d2omxb2, d2omxb3
    automated match to d2omza2
    complexed with ca, cl

    applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d2omxa3

PDB Entry: 2omx (more details), 1.7 Å

PDB Description: crystal structure of inla s192n g194s+s/hec1 complex
PDB Compounds: (A:) Internalin-A

SCOPe Domain Sequences for d2omxa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2omxa3 c.10.2.1 (A:36-417) Internalin A {Listeria monocytogenes [TaxId: 1639]}
atitqdtpinqiftdtalaekmktvlgktnvtdtvsqtdldqvttlqadrlgiksidgve
ylnnltqinfsnnqltditplknltklvdilmnnnqiaditplanltnltgltlfnnqit
didplknltnlnrlelssntisdisalsgltslqqlnfssnqvtdlkplanlttlerldi
ssnkvsdisvlakltnlesliatnnqisditplgiltnldelslngnqlkdigtlasltn
ltdldlannqisnlaplsgltkltelklganqisnisplagltaltnlelnenqledisp
isnlknltyltlyfnnisdispvssltklqrlffynnkvsdvsslanltninwlsaghnq
isdltplanltritqlglndqa

SCOPe Domain Coordinates for d2omxa3:

Click to download the PDB-style file with coordinates for d2omxa3.
(The format of our PDB-style files is described here.)

Timeline for d2omxa3:

View in 3D
Domains from same chain:
(mouse over for more information)
d2omxa1