SCOPe 2.06: Domain d2omua3: 2omu A:36-417

Lineage for d2omua3 (2omu A:36-417)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.1: Internalin LRR domain [52059] (4 proteins)
   capped at the N-end with a truncated EF-hand subdomain
   this is a repeat family; one repeat unit is 2omx A:261-239 found in domain

6. Protein Internalin A [82324] (1 species)

7. Species Listeria monocytogenes [TaxId:1639] [82325] (10 PDB entries)

8. Domain d2omua3: 2omu A:36-417 [238775]
   Other proteins in same PDB: d2omua1, d2omub2, d2omub3
   automated match to d2omza2
   complexed with ca, cl

Details for d2omua3

PDB Entry: 2omu, 1.8 Å

PDB Description: crystal structure of inla g194s+s y369s/hec1 complex

PDB Compounds: (A:) Internalin-A

SCOPe Domain Sequences for d2omua3:

Sequence; same for both SEQRES and ATOM records:

>d2omua3 c.10.2.1 (A:36-417) Internalin A {Listeria monocytogenes [TaxId: 1639]}
atitqdtpinqiftdtalaekmktvlgktnvtdtvsqtdldqvttlqadrlgiksidgve
ylnnltqinfsnnqltditplknltklvdilmnnnqiaditplanltnltgltlfnnqit
didplknltnlnrlelssntisdisalsgltslqqlsfssnqvtdlkplanlttlerldi
ssnkvsdisvlakltnlesliatnnqisditplgiltnldelslngnqlkdigtlasltn
ltdldlannqisnlaplsgltkltelklganqisnisplagltaltnlelnenqledisp
isnlknltyltlyfnnisdispvssltklqrlffsnnkvsdvsslanltninwlsaghnq
isdltplanltritqlglndqa

Timeline for d2omua3:

• d2omua3 first appeared in SCOPe 2.04
  
• d2omua3 appears in SCOPe 2.05
  
• d2omua3 appears in SCOPe 2.07
  
• d2omua3 appears in the current release, SCOPe 2.08