| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) ![]() less regular structure consisting of variable repeats |
| Family c.10.2.1: Internalin LRR domain [52059] (4 proteins) capped at the N-end with a truncated EF-hand subdomain this is a repeat family; one repeat unit is 2omx A:261-239 found in domain |
| Protein Internalin A [82324] (1 species) |
| Species Listeria monocytogenes [TaxId:1639] [82325] (10 PDB entries) |
| Domain d2omta3: 2omt A:36-417 [238774] Other proteins in same PDB: d2omta1, d2omtb2, d2omtb3 automated match to d2omza2 complexed with ca, cl applies to all domains of a family if the common domain is composed of a different number of small repeating units |
PDB Entry: 2omt (more details), 2 Å
SCOPe Domain Sequences for d2omta3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2omta3 c.10.2.1 (A:36-417) Internalin A {Listeria monocytogenes [TaxId: 1639]}
atitqdtpinqiftdtalaekmktvlgktnvtdtvsqtdldqvttlqadrlgiksidgve
ylnnltqinfsnnqltditplknltklvdilmnnnqiaditplanltnltgltlfnnqit
didplknltnlnrlelssntisdisalsgltslqqlsfssnqvtdlkplanlttlerldi
ssnkvsdisvlakltnlesliatnnqisditplgiltnldelslngnqlkdigtlasltn
ltdldlannqisnlaplsgltkltelklganqisnisplagltaltnlelnenqledisp
isnlknltyltlyfnnisdispvssltklqrlffynnkvsdvsslanltninwlsaghnq
isdltplanltritqlglndqa
Timeline for d2omta3: