Lineage for d2ocfa_ (2ocf A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1502431Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1502432Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1502433Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1502523Protein Estrogen receptor alpha [48519] (1 species)
  7. 1502524Species Human (Homo sapiens) [TaxId:9606] [48520] (60 PDB entries)
    Uniprot P03372 307-551
  8. 1502629Domain d2ocfa_: 2ocf A: [238772]
    Other proteins in same PDB: d2ocfd_
    automated match to d3q95b_
    complexed with est

Details for d2ocfa_

PDB Entry: 2ocf (more details), 2.95 Å

PDB Description: human estrogen receptor alpha ligand-binding domain in complex with estradiol and the e2#23 fn3 monobody
PDB Compounds: (A:) Estrogen receptor

SCOPe Domain Sequences for d2ocfa_:

Sequence, based on SEQRES records: (download)

>d2ocfa_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
fdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitd
tlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdllleml
dahr

Sequence, based on observed residues (ATOM records): (download)

>d2ocfa_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
fdmllatssrfrmmnlqgeefvclksiillnsgvytkdhihrvldkitdtlihlmakagl
tlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdlllemldahr

SCOPe Domain Coordinates for d2ocfa_:

Click to download the PDB-style file with coordinates for d2ocfa_.
(The format of our PDB-style files is described here.)

Timeline for d2ocfa_: