SCOPe 2.05: Domain d2o5jo_: 2o5j O:

Lineage for d2o5jo_ (2o5j O:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
   core: 2 helices and adjacent loops

4. Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families)
   the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits

5. Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
   4 helices; irregular array

6. Protein RNA polymerase omega subunit [63564] (3 species)

7. Species Thermus thermophilus HB8 [TaxId:300852] [158241] (6 PDB entries)

8. Domain d2o5jo_: 2o5j O: [238771]
   Other proteins in same PDB: d2o5jc_, d2o5jd_, d2o5jm_, d2o5jn_
   automated match to d1i6ve_
   protein/DNA complex; protein/RNA complex; complexed with apc, mg, zn

Details for d2o5jo_

PDB Entry: 2o5j, 3 Å

PDB Description: Crystal structure of the T. thermophilus RNAP polymerase elongation complex with the NTP substrate analog

PDB Compounds: (O:) DNA-directed RNA polymerase omega chain

SCOPe Domain Sequences for d2o5jo_:

Sequence; same for both SEQRES and ATOM records:

>d2o5jo_ a.143.1.1 (O:) RNA polymerase omega subunit {Thermus thermophilus HB8 [TaxId: 300852]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav
twamkelltgrlvfgenlvpedrlqkemerlypve

Timeline for d2o5jo_:

• d2o5jo_ first appeared in SCOPe 2.04
  
• d2o5jo_ appears in SCOPe 2.06
  
• d2o5jo_ appears in the current release, SCOPe 2.08