Lineage for d2tund_ (2tun D:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555454Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 555455Superfamily b.22.1: TNF-like [49842] (1 family) (S)
  5. 555456Family b.22.1.1: TNF-like [49843] (12 proteins)
  6. 555595Protein Tumor necrosis factor (TNF) [49848] (2 species)
  7. 555596Species Human (Homo sapiens) [TaxId:9606] [49849] (6 PDB entries)
  8. 555614Domain d2tund_: 2tun D: [23877]

Details for d2tund_

PDB Entry: 2tun (more details), 3.1 Å

PDB Description: conformational changes in the (ala-84-val) mutant of tumor necrosis factor

SCOP Domain Sequences for d2tund_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tund_ b.22.1.1 (D:) Tumor necrosis factor (TNF) {Human (Homo sapiens)}
tpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkg
qgcpsthvllthtisrivvsyqtkvnllsaikspcqretpegaeakpwyepiylggvfql
ekgdrlsaeinrpdyllfaesgqvyfgiial

SCOP Domain Coordinates for d2tund_:

Click to download the PDB-style file with coordinates for d2tund_.
(The format of our PDB-style files is described here.)

Timeline for d2tund_: