| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) ![]() |
| Family c.1.2.6: PdxS-like [141755] (2 proteins) Pfam PF01680; SOR/SNZ |
| Protein automated matches [193117] (4 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [230975] (2 PDB entries) |
| Domain d2nv2u_: 2nv2 U: [238768] Other proteins in same PDB: d2nv2b_, d2nv2d_, d2nv2f_, d2nv2h_, d2nv2j_, d2nv2l_, d2nv2n_, d2nv2p_, d2nv2r_, d2nv2t_, d2nv2v_, d2nv2x_ automated match to d2nv2i_ complexed with cl, edo, gln |
PDB Entry: 2nv2 (more details), 2.12 Å
SCOPe Domain Sequences for d2nv2u_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nv2u_ c.1.2.6 (U:) automated matches {Bacillus subtilis [TaxId: 1423]}
aqtgtervkrgmaemqkggvimdvinaeqakiaeeagavavmalervpadiraaggvarm
adptiveevmnavsipvmakarighivearvleamgvdyidesevltpadeefhlnkney
tvpfvcgcrdlgeatrriaegasmlrtkgepgtgniveavrhmrkvnaqvrkvvamsede
lmteaknlgapyelllqikkdgklpvvnfaaggvatpadaalmmqlgadgvfvgsgifks
dnpakfakaiveatthftdykliaelskelg
Timeline for d2nv2u_: