SCOPe 2.05: Domain d2nqbd_: 2nqb D:

Lineage for d2nqbd_ (2nqb D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein automated matches [193445] (6 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225310] (3 PDB entries)

8. Domain d2nqbd_: 2nqb D: [238764]
   Other proteins in same PDB: d2nqba_, d2nqbb_, d2nqbe_, d2nqbf_
   automated match to d3mgpd_
   protein/DNA complex

Details for d2nqbd_

PDB Entry: 2nqb, 2.3 Å

PDB Description: drosophila nucleosome structure

PDB Compounds: (D:) histone h2b

SCOPe Domain Sequences for d2nqbd_:

Sequence; same for both SEQRES and ATOM records:

>d2nqbd_ a.22.1.1 (D:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rkrkesyaiyiytvlkqvhpdtgisskamsimnsfvndiferiaaeasrlahynkrstit
sreiqtavrlllpgelakhavsegtkavtkytssk

Timeline for d2nqbd_:

• d2nqbd_ first appeared in SCOPe 2.04
  
• d2nqbd_ appears in SCOPe 2.06
  
• d2nqbd_ appears in the current release, SCOPe 2.08