Lineage for d2nqbd_ (2nqb D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725671Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1725672Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1725673Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1726113Protein automated matches [193445] (6 species)
    not a true protein
  7. 1726138Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225310] (3 PDB entries)
  8. 1726140Domain d2nqbd_: 2nqb D: [238764]
    Other proteins in same PDB: d2nqba_, d2nqbb_, d2nqbe_, d2nqbf_
    automated match to d3mgpd_
    protein/DNA complex

Details for d2nqbd_

PDB Entry: 2nqb (more details), 2.3 Å

PDB Description: drosophila nucleosome structure
PDB Compounds: (D:) histone h2b

SCOPe Domain Sequences for d2nqbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nqbd_ a.22.1.1 (D:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rkrkesyaiyiytvlkqvhpdtgisskamsimnsfvndiferiaaeasrlahynkrstit
sreiqtavrlllpgelakhavsegtkavtkytssk

SCOPe Domain Coordinates for d2nqbd_:

Click to download the PDB-style file with coordinates for d2nqbd_.
(The format of our PDB-style files is described here.)

Timeline for d2nqbd_: