![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
![]() | Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) ![]() |
![]() | Family a.40.1.0: automated matches [227151] (1 protein) not a true family |
![]() | Protein automated matches [226856] (4 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [255300] (3 PDB entries) |
![]() | Domain d2k3sa1: 2k3s A:6-119 [238762] Other proteins in same PDB: d2k3sa2, d2k3sb1 automated match to d1bhdb_ |
PDB Entry: 2k3s (more details)
SCOPe Domain Sequences for d2k3sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k3sa1 a.40.1.0 (A:6-119) automated matches {Mouse (Mus musculus) [TaxId: 10090]} knmllewcramtrnyehvdiqnfssswssgmafcalihkffpeafdyaeldpakrrhnft lafstaekladcaqllevddmvrlavpdskcvytyiqelyrslvqkglvktkkk
Timeline for d2k3sa1: