Lineage for d2k3sa1 (2k3s A:6-119)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712022Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2712023Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2712101Family a.40.1.0: automated matches [227151] (1 protein)
    not a true family
  6. 2712102Protein automated matches [226856] (4 species)
    not a true protein
  7. 2712187Species Mouse (Mus musculus) [TaxId:10090] [255300] (3 PDB entries)
  8. 2712190Domain d2k3sa1: 2k3s A:6-119 [238762]
    Other proteins in same PDB: d2k3sa2, d2k3sb1
    automated match to d1bhdb_

Details for d2k3sa1

PDB Entry: 2k3s (more details)

PDB Description: haddock-derived structure of the ch-domain of the smoothelin-like 1 complexed with the c-domain of apocalmodulin
PDB Compounds: (A:) Smoothelin-like protein 1

SCOPe Domain Sequences for d2k3sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k3sa1 a.40.1.0 (A:6-119) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
knmllewcramtrnyehvdiqnfssswssgmafcalihkffpeafdyaeldpakrrhnft
lafstaekladcaqllevddmvrlavpdskcvytyiqelyrslvqkglvktkkk

SCOPe Domain Coordinates for d2k3sa1:

Click to download the PDB-style file with coordinates for d2k3sa1.
(The format of our PDB-style files is described here.)

Timeline for d2k3sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2k3sa2
View in 3D
Domains from other chains:
(mouse over for more information)
d2k3sb1