SCOPe 2.08: Domain d2k3sa1: 2k3s A:6-119

Lineage for d2k3sa1 (2k3s A:6-119)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.0: automated matches [227151] (1 protein)
   not a true family

6. Protein automated matches [226856] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255300] (3 PDB entries)

8. Domain d2k3sa1: 2k3s A:6-119 [238762]
   Other proteins in same PDB: d2k3sa2, d2k3sb1
   automated match to d1bhdb_

Details for d2k3sa1

PDB Entry: 2k3s

PDB Description: haddock-derived structure of the ch-domain of the smoothelin-like 1 complexed with the c-domain of apocalmodulin

PDB Compounds: (A:) Smoothelin-like protein 1

SCOPe Domain Sequences for d2k3sa1:

Sequence; same for both SEQRES and ATOM records:

>d2k3sa1 a.40.1.0 (A:6-119) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
knmllewcramtrnyehvdiqnfssswssgmafcalihkffpeafdyaeldpakrrhnft
lafstaekladcaqllevddmvrlavpdskcvytyiqelyrslvqkglvktkkk

Timeline for d2k3sa1:

• d2k3sa1 first appeared in SCOPe 2.04, called d2k3sa_
  
• d2k3sa1 appears in SCOPe 2.07