![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
![]() | Superfamily a.5.2: UBA-like [46934] (5 families) ![]() |
![]() | Family a.5.2.1: UBA domain [46935] (25 proteins) |
![]() | Protein automated matches [190533] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255306] (4 PDB entries) |
![]() | Domain d2jy6b1: 2jy6 B:541-586 [238760] Other proteins in same PDB: d2jy6a_, d2jy6b2, d2jy6b3 automated match to d2dnaa1 |
PDB Entry: 2jy6 (more details)
SCOPe Domain Sequences for d2jy6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jy6b1 a.5.2.1 (B:541-586) automated matches {Human (Homo sapiens) [TaxId: 9606]} qnpevrfqqqleqlsamgflnreanlqaliatggdinaaierllgs
Timeline for d2jy6b1: