SCOPe 2.06: Domain d2jy6b1: 2jy6 B:541-586

Lineage for d2jy6b1 (2jy6 B:541-586)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (5 families)

5. Family a.5.2.1: UBA domain [46935] (25 proteins)

6. Protein automated matches [190533] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255306] (4 PDB entries)

8. Domain d2jy6b1: 2jy6 B:541-586 [238760]
   Other proteins in same PDB: d2jy6a_, d2jy6b2, d2jy6b3
   automated match to d2dnaa1

Details for d2jy6b1

PDB Entry: 2jy6

PDB Description: solution structure of the complex of ubiquitin and ubiquilin 1 uba domain

PDB Compounds: (B:) Ubiquilin-1

SCOPe Domain Sequences for d2jy6b1:

Sequence; same for both SEQRES and ATOM records:

>d2jy6b1 a.5.2.1 (B:541-586) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnpevrfqqqleqlsamgflnreanlqaliatggdinaaierllgs

Timeline for d2jy6b1:

• d2jy6b1 first appeared in SCOPe 2.04, called d2jy6b_
  
• d2jy6b1 was called d2jy6b_ in SCOPe 2.05
  
• d2jy6b1 appears in SCOPe 2.07
  
• d2jy6b1 appears in the current release, SCOPe 2.08