Class a: All alpha proteins [46456] (285 folds) |
Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
Superfamily a.5.2: UBA-like [46934] (5 families) |
Family a.5.2.1: UBA domain [46935] (25 proteins) |
Protein automated matches [190533] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255306] (4 PDB entries) |
Domain d2jy6b_: 2jy6 B: [238760] Other proteins in same PDB: d2jy6a_ automated match to d2dnaa1 |
PDB Entry: 2jy6 (more details)
SCOPe Domain Sequences for d2jy6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jy6b_ a.5.2.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gspefqnpevrfqqqleqlsamgflnreanlqaliatggdinaaierllgss
Timeline for d2jy6b_: