Lineage for d2jy6b_ (2jy6 B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1480920Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1480944Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 1480945Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 1481039Protein automated matches [190533] (3 species)
    not a true protein
  7. 1481068Species Human (Homo sapiens) [TaxId:9606] [255306] (4 PDB entries)
  8. 1481070Domain d2jy6b_: 2jy6 B: [238760]
    Other proteins in same PDB: d2jy6a_
    automated match to d2dnaa1

Details for d2jy6b_

PDB Entry: 2jy6 (more details)

PDB Description: solution structure of the complex of ubiquitin and ubiquilin 1 uba domain
PDB Compounds: (B:) Ubiquilin-1

SCOPe Domain Sequences for d2jy6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jy6b_ a.5.2.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gspefqnpevrfqqqleqlsamgflnreanlqaliatggdinaaierllgss

SCOPe Domain Coordinates for d2jy6b_:

Click to download the PDB-style file with coordinates for d2jy6b_.
(The format of our PDB-style files is described here.)

Timeline for d2jy6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2jy6a_