Lineage for d2tunc_ (2tun C:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12261Fold b.22: TNF-like [49841] (1 superfamily)
  4. 12262Superfamily b.22.1: TNF-like [49842] (1 family) (S)
  5. 12263Family b.22.1.1: TNF-like [49843] (4 proteins)
  6. 12286Protein Tumor necrosis factor (TNF) [49848] (2 species)
  7. 12287Species Human (Homo sapiens) [TaxId:9606] [49849] (6 PDB entries)
  8. 12304Domain d2tunc_: 2tun C: [23876]

Details for d2tunc_

PDB Entry: 2tun (more details), 3.1 Å

PDB Description: conformational changes in the (ala-84-val) mutant of tumor necrosis factor

SCOP Domain Sequences for d2tunc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tunc_ b.22.1.1 (C:) Tumor necrosis factor (TNF) {Human (Homo sapiens)}
tpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkg
qgcpsthvllthtisrivvsyqtkvnllsaikspcqretpegaeakpwyepiylggvfql
ekgdrlsaeinrpdyllfaesgqvyfgiial

SCOP Domain Coordinates for d2tunc_:

Click to download the PDB-style file with coordinates for d2tunc_.
(The format of our PDB-style files is described here.)

Timeline for d2tunc_: