SCOPe 2.04: Domain d2jtib_: 2jti B:

Lineage for d2jtib_ (2jti B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (6 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (52 PDB entries)
   Uniprot P00044

8. Domain d2jtib_: 2jti B: [238759]
   Other proteins in same PDB: d2jtia_
   automated match to d1ycca_
   complexed with hec, hem

Details for d2jtib_

PDB Entry: 2jti

PDB Description: solution structure of the yeast iso-1-cytochrome c (t12a) : yeast cytochrome c peroxidase complex

PDB Compounds: (B:) Cytochrome c iso-1

SCOPe Domain Sequences for d2jtib_:

Sequence; same for both SEQRES and ATOM records:

>d2jtib_ a.3.1.1 (B:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gsakkgatlfkarclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknvlwd
ennmseyltnpkkyipgtkmafgglkkekdrndlitylkkace

Timeline for d2jtib_:

• d2jtib_ is new in SCOPe 2.04-stable
  
• d2jtib_ appears in SCOPe 2.05
  
• d2jtib_ appears in the current release, SCOPe 2.08