Lineage for d2tunb_ (2tun B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532068Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1532069Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 1532070Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 1532265Protein Tumor necrosis factor (TNF) [49848] (2 species)
  7. 1532266Species Human (Homo sapiens) [TaxId:9606] [49849] (13 PDB entries)
  8. 1532301Domain d2tunb_: 2tun B: [23875]
    mutant

Details for d2tunb_

PDB Entry: 2tun (more details), 3.1 Å

PDB Description: conformational changes in the (ala-84-val) mutant of tumor necrosis factor
PDB Compounds: (B:) tumor necrosis factor-alpha

SCOPe Domain Sequences for d2tunb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tunb_ b.22.1.1 (B:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]}
tpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkg
qgcpsthvllthtisrivvsyqtkvnllsaikspcqretpegaeakpwyepiylggvfql
ekgdrlsaeinrpdyllfaesgqvyfgiial

SCOPe Domain Coordinates for d2tunb_:

Click to download the PDB-style file with coordinates for d2tunb_.
(The format of our PDB-style files is described here.)

Timeline for d2tunb_: