SCOPe 2.07: Domain d2jj2b3: 2jj2 B:380-509

Lineage for d2jj2b3 (2jj2 B:380-509)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (17 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [255272] (6 PDB entries)

8. Domain d2jj2b3: 2jj2 B:380-509 [238745]
   Other proteins in same PDB: d2jj2a1, d2jj2a2, d2jj2b1, d2jj2b2, d2jj2c1, d2jj2c2, d2jj2d1, d2jj2d2, d2jj2d3, d2jj2e1, d2jj2e2, d2jj2e3, d2jj2f1, d2jj2f2, d2jj2f3, d2jj2g_, d2jj2h1, d2jj2h2, d2jj2i1, d2jj2i2, d2jj2j1, d2jj2j2, d2jj2k1, d2jj2k2, d2jj2k3, d2jj2l1, d2jj2l2, d2jj2l3, d2jj2m1, d2jj2m2, d2jj2m3, d2jj2n_
   automated match to d1maba1
   complexed with adp, anp, azi, gol, mg, po4, que

Details for d2jj2b3

PDB Entry: 2jj2, 2.4 Å

PDB Description: the structure of f1-atpase inhibited by quercetin.

PDB Compounds: (B:) ATP synthase subunit alpha heart isoform

SCOPe Domain Sequences for d2jj2b3:

Sequence, based on SEQRES records:

>d2jj2b3 a.69.1.0 (B:380-509) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallskirtdgkiseesdaklke
ivtnflagfe

Sequence, based on observed residues (ATOM records):

>d2jj2b3 a.69.1.0 (B:380-509) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaldaatqqllsrgvrltellkqgqyspmaieeqvaviya
gvrgyldklepskitkfenaflshvisqhqallskirtdgkiseesdaklkeivtnflag
fe

Timeline for d2jj2b3:

• d2jj2b3 first appeared in SCOPe 2.04
  
• d2jj2b3 appears in SCOPe 2.06
  
• d2jj2b3 appears in the current release, SCOPe 2.08