SCOPe 2.07: Domain d2jj1c3: 2jj1 C:380-510

Lineage for d2jj1c3 (2jj1 C:380-510)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (17 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [255272] (6 PDB entries)

8. Domain d2jj1c3: 2jj1 C:380-510 [238730]
   Other proteins in same PDB: d2jj1a1, d2jj1a2, d2jj1b1, d2jj1b2, d2jj1c1, d2jj1c2, d2jj1d1, d2jj1d2, d2jj1d3, d2jj1e1, d2jj1e2, d2jj1e3, d2jj1f1, d2jj1f2, d2jj1f3, d2jj1g_, d2jj1h1, d2jj1h2, d2jj1i1, d2jj1i2, d2jj1j1, d2jj1j2, d2jj1k1, d2jj1k2, d2jj1k3, d2jj1l1, d2jj1l2, d2jj1l3, d2jj1m1, d2jj1m2, d2jj1m3, d2jj1n_
   automated match to d1maba1
   complexed with adp, anp, azi, gol, mg, pit, po4

Details for d2jj1c3

PDB Entry: 2jj1, 2.7 Å

PDB Description: the structure of f1-atpase inhibited by piceatannol.

PDB Compounds: (C:) ATP synthase subunit alpha heart isoform

SCOPe Domain Sequences for d2jj1c3:

Sequence; same for both SEQRES and ATOM records:

>d2jj1c3 a.69.1.0 (C:380-510) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallskirtdgkiseesdaklke
ivtnflagfea

Timeline for d2jj1c3:

• d2jj1c3 first appeared in SCOPe 2.04
  
• d2jj1c3 appears in SCOPe 2.06
  
• d2jj1c3 appears in the current release, SCOPe 2.08