Lineage for d1tnfc_ (1tnf C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2048772Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2048773Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2048774Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2048971Protein Tumor necrosis factor (TNF) [49848] (2 species)
  7. 2048972Species Human (Homo sapiens) [TaxId:9606] [49849] (19 PDB entries)
  8. 2049021Domain d1tnfc_: 1tnf C: [23873]

Details for d1tnfc_

PDB Entry: 1tnf (more details), 2.6 Å

PDB Description: the structure of tumor necrosis factor-alpha at 2.6 angstroms resolution. implications for receptor binding
PDB Compounds: (C:) tumor necrosis factor-alpha

SCOPe Domain Sequences for d1tnfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tnfc_ b.22.1.1 (C:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]}
rtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfk
gqgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfq
lekgdrlsaeinrpdyllfaesgqvyfgiial

SCOPe Domain Coordinates for d1tnfc_:

Click to download the PDB-style file with coordinates for d1tnfc_.
(The format of our PDB-style files is described here.)

Timeline for d1tnfc_: