SCOPe 2.07: Domain d2jizh3: 2jiz H:380-510

Lineage for d2jizh3 (2jiz H:380-510)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (17 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [255272] (6 PDB entries)

8. Domain d2jizh3: 2jiz H:380-510 [238715]
   Other proteins in same PDB: d2jiza1, d2jiza2, d2jizb1, d2jizb2, d2jizc1, d2jizc2, d2jizd1, d2jizd2, d2jizd3, d2jize1, d2jize2, d2jize3, d2jizf1, d2jizf2, d2jizf3, d2jizg_, d2jizh1, d2jizh2, d2jizi1, d2jizi2, d2jizj1, d2jizj2, d2jizk1, d2jizk2, d2jizk3, d2jizl1, d2jizl2, d2jizl3, d2jizm1, d2jizm2, d2jizm3, d2jizn_
   automated match to d1maba1
   complexed with adp, anp, azi, gol, mg, po4, stl

Details for d2jizh3

PDB Entry: 2jiz, 2.3 Å

PDB Description: the structure of f1-atpase inhibited by resveratrol.

PDB Compounds: (H:) ATP synthase subunit alpha heart isoform

SCOPe Domain Sequences for d2jizh3:

Sequence; same for both SEQRES and ATOM records:

>d2jizh3 a.69.1.0 (H:380-510) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallskirtdgkiseesdaklke
ivtnflagfea

Timeline for d2jizh3:

• d2jizh3 first appeared in SCOPe 2.04
  
• d2jizh3 appears in SCOPe 2.06
  
• d2jizh3 appears in the current release, SCOPe 2.08