Lineage for d2jizc3 (2jiz C:380-510)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717538Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 2717539Protein automated matches [254528] (17 species)
    not a true protein
  7. 2717574Species Cow (Bos taurus) [TaxId:9913] [255272] (6 PDB entries)
  8. 2717580Domain d2jizc3: 2jiz C:380-510 [238712]
    Other proteins in same PDB: d2jiza1, d2jiza2, d2jizb1, d2jizb2, d2jizc1, d2jizc2, d2jizd1, d2jizd2, d2jizd3, d2jize1, d2jize2, d2jize3, d2jizf1, d2jizf2, d2jizf3, d2jizg_, d2jizh1, d2jizh2, d2jizi1, d2jizi2, d2jizj1, d2jizj2, d2jizk1, d2jizk2, d2jizk3, d2jizl1, d2jizl2, d2jizl3, d2jizm1, d2jizm2, d2jizm3, d2jizn_
    automated match to d1maba1
    complexed with adp, anp, azi, gol, mg, po4, stl

Details for d2jizc3

PDB Entry: 2jiz (more details), 2.3 Å

PDB Description: the structure of f1-atpase inhibited by resveratrol.
PDB Compounds: (C:) ATP synthase subunit alpha heart isoform

SCOPe Domain Sequences for d2jizc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jizc3 a.69.1.0 (C:380-510) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallskirtdgkiseesdaklke
ivtnflagfea

SCOPe Domain Coordinates for d2jizc3:

Click to download the PDB-style file with coordinates for d2jizc3.
(The format of our PDB-style files is described here.)

Timeline for d2jizc3: