Lineage for d1tnfa_ (1tnf A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 793598Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 793599Superfamily b.22.1: TNF-like [49842] (1 family) (S)
  5. 793600Family b.22.1.1: TNF-like [49843] (14 proteins)
  6. 793773Protein Tumor necrosis factor (TNF) [49848] (2 species)
  7. 793774Species Human (Homo sapiens) [TaxId:9606] [49849] (7 PDB entries)
  8. 793790Domain d1tnfa_: 1tnf A: [23871]

Details for d1tnfa_

PDB Entry: 1tnf (more details), 2.6 Å

PDB Description: the structure of tumor necrosis factor-alpha at 2.6 angstroms resolution. implications for receptor binding
PDB Compounds: (A:) tumor necrosis factor-alpha

SCOP Domain Sequences for d1tnfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tnfa_ b.22.1.1 (A:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]}
rtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfk
gqgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfq
lekgdrlsaeinrpdyllfaesgqvyfgiial

SCOP Domain Coordinates for d1tnfa_:

Click to download the PDB-style file with coordinates for d1tnfa_.
(The format of our PDB-style files is described here.)

Timeline for d1tnfa_: